"ddl$m?Z@ddl$mAZBddlCmDZDddlEmFZGddlHmIZIddlJmKZKddlLmMZMmNZNddlOZOddlPZOddlQmRZRmSZSddlTmUZUddlVm;Z;ddlWmXZXddlYmZZZddl[m\Z\m=Z=ddl]m^Z^ddl_m`Z`m?Z?dd lambZbdd!lcmdZddd"lemfZfmgZgmhZhdd#limjZjdd$lkmFZFmlZldd%lmmnZndd&lompZpdd'lqmrZrmsZsmtZtdd(lumvZvdd)lwmxZxmAZAmyZydd*lzm{Z{dd+l|m}Z}dd,l~mZdd-lmZdd.lmZmZdd/lmZmZer:dd0lmZdd1lmZdd2lmZmZdd3lmZdd4lmZmZdd5lmZdd6lmZdd7lmZdd8lwmZeeZdSd>Zed?Zed@ZejdAZe dBgee-fZedTdEZdUdHZGdIdJee-ZeGdKdLZdVdOZdVdPZdWdRZdS)Xz5FastMCP - A more ergonomic interface for MCP servers.) annotationsN) AsyncIterator AwaitableCallable CollectionMappingSequence)AbstractAsyncContextManagerAsyncExitStackasynccontextmanagersuppress) dataclass)partial)Path) TYPE_CHECKINGAnyGenericLiteralcastoverload)DocketWorker)ReadResourceContents)LifespanResultTNotificationOptions) stdio_server)McpError)METHOD_NOT_FOUND Annotations AnyFunctionCallToolRequestParams ContentBlock ErrorDataGetPromptResultToolAnnotations)Prompt)Resource)ResourceTemplate)Tool)AnyUrl) Middleware)Request)Response) BaseRouteRoute) DisabledError NotFoundError) MCPConfig)FunctionPrompt) PromptManager)FunctionResourcer')ResourceManager)FunctionResourceTemplater() AuthProvider) EventStore)StarletteWithLifespancreate_sse_appcreate_streamable_http_app)LowLevelServer)r+MiddlewareContext)get_task_capabilities) TaskConfig)handle_prompt_as_taskhandle_resource_as_taskhandle_tool_as_task)Settings) FunctionToolr) ToolResult) ToolManager)ToolTransformConfig)log_server_banner)FastMCPComponent) get_loggertemporary_log_level)NotSetNotSetTClient)FastMCP1Server)ClientTransportClientTransportT) ComponentFn)FastMCPOpenAPIRouteMap) RouteMapFn FastMCPProxy)ServerSamplingHandler)ToolResultSerializerTypefnCallable[..., Any]namestrreturnc`ddl}|dfd }||_|S) a#Create a wrapper function with a custom __name__ for Docket registration. Docket uses fn.__name__ as the key for function registration and lookup. When mounting servers, we need unique names to avoid collisions between mounted servers that have identically-named functions. rNargsrkwargsr`c$K|i|d{VSN)rbrcr\s /Users/kimhansen/Desktop/03 Workspace/ceo-agents/chl-effectiveness/mcp-servers/whoop/.venv/lib/python3.11/site-packages/fastmcp/server/server.pywrapperz)_create_named_fn_wrapper..wrapperus.R(((((((((()rbrrcrr`r) functoolswraps__name__)r\r^rjrhs` rg_create_named_fn_wrapperrmlsU__R))))))G Nri)warnerrorreplaceignore)stdiohttpssestreamable-httpz^([^:]+://)(.*?)$FastMCP[LifespanResultT]serverAsyncIterator[Any]cKiWVdS)zDefault lifespan context manager that does nothing. Args: server: The server instance this lifespan is managing Returns: An empty dictionary as the lifespan result. Nrf)rws rgdefault_lifespanrzs HHHHHHrifastmcp_serverYCallable[[LowLevelServer[LifespanResultT]], AbstractAsyncContextManager[LifespanResultT]]c.tdfd }|S)Nlow_level_serverLowLevelServer[LifespanResultT]r`AsyncIterator[LifespanResultT]cvKjturiWVdSjstdjWVdS)NaFastMCP server has a lifespan defined but no lifespan result is set, which means the server's context manager was not entered. Are you running the server in a way that supports lifespans? If so, please file an issue at https://github.com/jlowin/fastmcp/issues.) _lifespanrz_lifespan_result_set RuntimeError_lifespan_result)r~r{s rgwrapz_lifespan_proxy..wrapse  #'7 7 7HHHH F2 [  -------ri)r~rr`r)r )r{rs` rg_lifespan_proxyrs5  . . . . . . KriceZdZ ddddedddddddddddddddddddddddddddd0Zdd3Zdd5Zedd7Zedd8Z edd9Z e j dd;Z edd<Z edd=Z edd?Zed dAZed dCZd dHZed dIZ d d dQZ d d dRZddSZddTZddUZddVZdd[Zdd]Zdd_ZddbZdddZddgZddiZ ddkZ!ddmZ"ddoZ#ddqZ$ddsZ% d ddyZ&dd{Z'dd}Z(ddZ)ddZ*d dZ+d!dZ,d"dZ-d#dZ.d$dZ/d%dZ0d&dZ1d'dZ2d(dZ3d)dZ4d*dZ5d+dZ6d,dZ7d,dZ8d-dZ9 d.d/dZ: d.d/dZ;d0dZ<d1dZ=d2dZ>d3dZ?d4dZ@eAdddddedddddd d5dZBeA d.dddddedddddd d6dÄZB d.dddddedddddd d7dƄZBd8dȄZCd9dʄZDddddddddddd˜ d:dτZEd;dфZFeAdddddddddҜdd؄ZG d?d@dلZH dAdBdބZI dCdDdZJ ddEdZK d.dFdZLeM dGdHdZNeM dIdJdZOeMdKdZPdLdZQeMd.dMdZRdS(NFastMCPN)version website_urliconsauth middlewarelifespanmask_error_detailstoolstool_transformationstool_serializer include_tags exclude_tagsinclude_fastmcp_metaon_duplicate_toolson_duplicate_resourceson_duplicate_promptsstrict_input_validationtasks log_leveldebughostportsse_path message_pathstreamable_http_path json_responsestateless_httpsampling_handlersampling_handler_behaviorr^ str | None instructionsrrrlist[mcp.types.Icon] | NonerAuthProvider | NotSetT | NonerSequence[Middleware] | NonerLifespanCallable | Noner bool | Noner*Sequence[Tool | Callable[..., Any]] | Noner(Mapping[str, ToolTransformConfig] | NonerToolResultSerializerType | NonerCollection[str] | NonerrrDuplicateBehavior | Nonerrrrrrrr int | Nonerrrrrr-ServerSamplingHandler[LifespanResultT] | Noner$Literal['always', 'fallback'] | Nonec ||nd|_d|_g|_g|_d|_t || | |_t|| |_t|| |_ | |_ |pt|_ d|_d|_t!j|_t't(||p||p t,j|||t1||_|t4ur2t,jjt,j}nd}t=t>dz||_ | rJ| D]G} tC| tDstEj#| |j } |$| H| tK| nd|_&|tK|nd|_'||nt,jj(|_(tS|pg|_*|+||_,|pd|_-||nt,jj.|_.|/||||||||| dS) NF)duplicate_behaviorrtransformations)rr)r{)fastmcpr^rrrrr) serializerfallback) rrrrrrrrr)0_support_tasks_by_default_docket_additional_http_routes_mounted_servers _is_mountedrG _tool_managerr6_resource_managerr4_prompt_manager_tool_serializerrzrrrasyncioEvent_startedr=r generate_namer __version__r _mcp_serverrMsettings server_authserver_auth_classrr8r isinstancer) from_functionadd_toolsetrrrlistr_setup_handlersrrr_handle_deprecated_settings)!selfr^rrrrrrrrrrrrrrrrrrrrrrrrrrrrrrtools! rg__init__zFastMCP.__init__sR9>8Iuuu& 8:$57  +6110+ + +  3B513 3 3 /<31/ / / >M>+7'99;;)-lT.A4)H)H  $ $ $!$--V-dt?TUUUD d####".!9C   t ".!9C   t  '2 $ #!9 $ -11Ar,B,B    & 3 & $/ ! !6 ! ((%!5') ) rir`r_c@t|jd|jdS)N())typerlr^rs rg__repr__zFastMCP.__repr__<s$t**%66 6666riNonec $i} d|fd|fd|fd|fd|fd|fd|fd|fd | ff D]=\} } | 6tjjr tjd | d t d | | | <>tj| z} tdi| |_d S)z0Handle deprecated settings. Deprecated in 2.8.0.rrrrrrrrrNz Providing `ze` when creating a server is deprecated. Provide it when calling `run` or as a global setting instead. stacklevelrf) rrdeprecation_warningswarningsrnDeprecationWarning model_dumprD_deprecated_settings)rrrrrrrrrrdeprecated_settingsr^argcombined_settingss rgrz#FastMCP._handle_deprecated_settings?s/1) $ e  TN TN  " \ * #%9 : m , ~ .   0 0ID##8MRdRRR*#$ -0#D)#,7799f|jm|j j!D]A} t'| tDr*| jjdkr|| jB|j j#D]A} t'| tHr*| jjdkr|| jB|j%D])} |&| j'|| j(d{V*||} |j j)|j j*|j j+d} |j j,r|j j,| d <t[|fi| 4d{V}||} t]j/|0} dWV|1tet\j3t\j45t]j5|d d{Vdddn #1swxYwYnq#|1tet\j3t\j45t]j5|d d{Vdddw#1swxYwYwxYw| |n#| |wxYw dddd{Vn#1d{VswxYwY| | d|_n!#| | d|_wxYw dddd{Vn#1d{VswxYwY| |dS#| |wxYw) z@Manage Docket instance and Worker for background task execution.r)r)_current_docket_current_server_current_workerN)r^url forbidden.) concurrencyredelivery_timeoutreconnection_delayr^g@)timeout)6rrfastmcp.server.dependenciesrrrrweakrefrefrresetrrr^rrr_toolsvaluesrrE task_configmoderegisterr\r_promptsr3rrrrr _resourcesr5 _templatesr7r"_register_mounted_server_functionsrwprefixrrr worker_namerr create_task run_forevercancelr CancelledError TimeoutErrorwait_for)rrrrr server_tokenrrpromptresourcetemplatemounted docket_token worker_kwargsworker worker_token worker_tasks rg_docket_lifespanzFastMCP._docket_lifespans^ %$$$$$          '**7;t+<+<== [ 0 j  ! !, / / / / /e_)O'O (O (O (O (O (O (O (O (% !.5<<>>11D"4661 ,1[@@000"2;BBDDXXF"6>::X".3{BBXc9S>6I-JFI(V(VWWW $ 6 A H H J J55H"8-=>>5$05DD 444 $ 6 A H H J J55H"8-EFF5$05DD 444 $4GAA /226:: ((0'B.6o.P.6o.P55M  2L080K f- &f>> >>@@@@@@@&'6':':6'B'B  @*1*=f>P>P>R>R*S*SKU %!, 2 2 4 4 4%-$+$:G> * *F6>22 *&+{::6<LV22fj222&*3#y~"56 BBG)))0;BBDD * *H8%566 *(-<<9?RV55hm555X]3HKII)))0;BBDD * *H8%=>> *(-<<9?RV55hm555X]3HKII)))-  F/$m/6++FM+++-   99 v}           ricK|jrdWVdS||4d{V }|4d{V||_d|_t t dz4d{V}|jD]5}||j d{V6|j  dWV|j n#|j wxYw dddd{Vn#1d{VswxYwYdddd{Vn#1d{VswxYwYdddd{Vn#1d{VswxYwYd|_d|_dS)NT)cmF) rrr"rr boolrenter_async_contextrw_lifespan_managerrrclear)ruser_lifespan_resultstackrws rgr.zFastMCP._lifespan_manager@sP  $  EEEE F NN4  * * * * * * * *$8  ! ! # # * * * * * * * *%9D !(,D %%dTk244 * * * * * * *"3F33!=::<<4 !!###*EEEEM''))))DM''))))) * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * *&%*! $srE'1E9AD!C0D!0D D!E! D+ +E.D+ /E2E' E E'E E'' E14E1T transportTransport | None show_bannerr,transport_kwargsrcK|d}|dvrtd||dkr|jdd|i|d{VdS|dvr|jd||d|d{VdStd|) zRun the FastMCP server asynchronously. Args: transport: Transport protocol to use ("stdio", "sse", or "streamable-http") Nrr>rtrsrrruzUnknown transport: r4>rtrsru)r2r4rf) ValueErrorrun_stdio_asyncrun_http_asyncrr2r4r5s rg run_asynczFastMCP.run_async\s  I G G G>9>>?? ?   &$&'"         < < <%$%#'#          >9>>?? ?ric Ttjt|j|fd|i|dS)zRun the FastMCP server. Note this is a synchronous function. Args: transport: Transport protocol to use ("stdio", "sse", or "streamable-http") r4N)anyiorunrr;r:s rgr>z FastMCP.runzsP    ( #        ric|j|j|j|j|j|j|j|j|j |j |j | | |dS)z"Set up core MCP protocol handlers.)validate_inputN)r list_tools_list_tools_mcplist_resources_list_resources_mcplist_resource_templates_list_resource_templates_mcp list_prompts_list_prompts_mcp call_toolr_call_tool_mcp_setup_read_resource_handler_setup_get_prompt_handler_setup_task_protocol_handlersrs rgrzFastMCP._setup_handlerss%##%%d&:;;;)''))$*BCCC2002243TUUU'%%''(>???O""$2N"OO      ))+++ &&((( **,,,,,ricPdfd }|jjtjj<dS)a  Set up custom read_resource handler that supports task-augmented responses. The SDK's read_resource decorator doesn't support CreateTaskResult returns, so we register a custom handler that checks request_context.experimental.is_task. reqmcp.types.ReadResourceRequestr`mcp.types.ServerResultc K|jj}d} jj}|jjr |jj}n#ttf$rYnwxYwtj j 4d{V t|d{V}|r |rt!|dr|jj}|dkr)|s't't)t*d|d|rp|dkrjt-|t.t0zrM|d }t5 t|||d{Vcdddd{VS|r-|dkr't't)t*d|d  dddd{Vn#1d{VswxYwY |d{V}|r)g}|D]} t-| jtrB|t<j || j| j!pd ^t-| jtDrjd dl#} |t<j$|| %| j&| j!pdt<j't<j(|dddiiSt-|t<jj'r|Sg}|D]} t-| jtrB|t<j || j| j!pd ^t-| jtDrjd dl#} |t<j$|| %| j&| j!pdt<j't<j(|S)Nrr requiredz Resource '#' requires task-augmented executioncodemessagerT exclude_none+' does not support task-augmented executionz text/plain)uritextmimeTyperzapplication/octet-stream)r\blobr^modelcontextprotocol.io/taskreturned_immediately)contents_meta)rb))paramsr\rrequest_context experimentalis_task task_metadataAttributeError LookupErrorrrwcontextContext!_get_resource_or_template_or_noner__should_enable_componenthasattrr r rr#rrr5r7rrB_read_resource_mcpcontentappendmcptypesTextResourceContents mime_typebytesbase64BlobResourceContents b64encodedecode ServerResultReadResourceResult) rOr\ task_metactxr task_modetask_meta_dictresult mcp_contentsitemrxrs rghandlerz5FastMCP._setup_read_resource_handler..handlers*.CI &6#+? # 0 >I"K0    ~-55d5CC' ' ' ' ' ' ' ' !%!G!GC!Q!QQQQQQQ$55h??$ -88$ !) 4 9I!J..y.&%%5(]S(](](]! Y+%=%=%$,/GG.7-A-At-A-T-TN)@ $c#hh.**$$$$$$7' ' ' ' ' ' ' ' ' ' ' ' ' ' B!Y+%=%=&%%5(eS(e(e(eE' ' ' ' ' ' ' ' ' ' ' ' ' ' ' ' ' ' ' ' ' ' ' ' ' ' ' T 22377777777F ! "D!$,44$++I::$'%)\)-)G<;$DL%88 % $++I::$'%+%5%5dl%C%C%J%J%L%L)-)U;U;y--I00!-: 6=1   &#)"899  L  dlC00 '' 66 #!%%)^%C|7  e44 !MMM '' 66 #!'!1!1$,!?!?!F!F!H!H%)^%Q7Q79)) ,,l,CC s($8A  A :C+F:8/F:: GGN)rOrPr`rQ)rrequest_handlersrsrtReadResourceRequestrrs` rgrKz$FastMCP._setup_read_resource_handlersGv v v v v v pLS)#)*GHHHricPdfd }|jjtjj<dS)a Set up custom get_prompt handler that supports task-augmented responses. The SDK's get_prompt decorator doesn't support CreateTaskResult returns, so we register a custom handler that checks request_context.experimental.is_task. rOmcp.types.GetPromptRequestr`rQc (K|jj}|jj}d} jj}|jjr |jj}n#ttf$rYnwxYwtj j 4d{V d{V}||}|r |rt#|dr|jr|jj}|dkr)|s't)t+t,d|d|re|dkr_|d }t1 |||d{V} t2j| cdddd{VS|r-|dkr't)t+t,d|d  dddd{Vn#1d{VswxYwY ||d{V} t2j| S) NrSr rTzPrompt 'rUrVrTrYr[)rdr^ argumentsrrerfrgrhrirjrrwrkrl get_promptsgetrnror r rr#rrrArsrtr|_get_prompt_mcp) rOr^rr~rpromptsrrrrrs rgrz2FastMCP._setup_get_prompt_handler..handler)sM:?D ,II &6#+? # 0 >I"K0    ~-55d5CC$ $ $ $ $ $ $ $  $ 0 0 2 2222222 T**!55f==!  66!* ! !' 2 7I!J..y.&%%5(\4(\(\(\!>Y+%=%=)2)=)=4)=)P)P'< $ >(("""""" #y55f==5$ $ $ $ $ $ $ $ $ $ $ $ $ $ <!Y+%=%=&%%5(d4(d(d(d?$ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ N //i@@@@@@@@F9))&11 1s*$AAAC-G/G GGN)rOrr`rQ)rrrsrtGetPromptRequestrs` rgrLz!FastMCP._setup_get_prompt_handler!sA6 26 26 26 26 26 2pIP)#)*DEEEric ddlm}m}m}m}m ddlm m m m d fd }d fd }d fd }d fd }|j j |<|j j |<|j j |<|j j |<dS)z2Register SEP-1686 task protocol handlers with SDK.r)CancelTaskRequestGetTaskPayloadRequestGetTaskRequestListTasksRequestr|)tasks_cancel_handlertasks_get_handlertasks_list_handlertasks_result_handlerrOrr`r|czK|jdd}|d{V}|SNT)by_aliasrZrdr)rOrdrr|rrs rghandle_get_taskz>FastMCP._setup_task_protocol_handlers..handle_get_taskwsUZ**Dt*LLF,,T6::::::::F<'' 'rirczK|jdd}|d{V}|Srr)rOrdrr|rrs rghandle_get_task_resultzEFastMCP._setup_task_protocol_handlers..handle_get_task_result|UZ**Dt*LLF//f========F<'' 'rircK|jr|jddni}|d{V}|Srr)rOrdrr|rrs rghandle_list_tasksz@FastMCP._setup_task_protocol_handlers..handle_list_taskssk: %%t$%GGG  .-dF;;;;;;;;F<'' 'rirczK|jdd}|d{V}|Srr)rOrdrr|rrs rghandle_cancel_taskzAFastMCP._setup_task_protocol_handlers..handle_cancel_taskrriN)rOrr`r|)rOrr`r|)rOrr`r|)rOrr`r|) mcp.typesrrrrr|fastmcp.server.tasks.protocolrrrrrr)rrrrrrrrrr|rrrrs` @@@@@rgrMz%FastMCP._setup_task_protocol_handlerscs|                           ( ( ( ( ( ( ( (  ( ( ( ( ( ( ( (  ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( =L).9 " )*?@?P)*:;?Q)*;<<> ,  G $+N$<$<$>$>>>>>>> !,!2!2!4!4FFIC;B>R77#777sG)-W)E)EIg&&F   [w~?R[[XY[[#J  A'B!! C1+!+C@@@ #> .6m GN!D!DX]!D!DEE .6-@-@#F.A..M'**    _7>CV__\]__#J  sBC D!+C@@@  .0F~9#=Q07-P-P-P-PF6N18~.-5-@-@#F.A..M'**   hGNL_hhefhh#J  sBC D$R77#777sG+1+<+<+<+I+IK((J   ]AT]]Z[]]#J  rr&cvK|d{V}||vrtd|||S)NUnknown prompt: )rr1)rr%rs rg get_promptzFastMCP.get_prompt:sU((******** g   83 8 899 9s|ripathmethods list[str]include_in_schema^Callable[[Callable[[Request], Awaitable[Response]]], Callable[[Request], Awaitable[Response]]]c$dfd }|S)a Decorator to register a custom HTTP route on the FastMCP server. Allows adding arbitrary HTTP endpoints outside the standard MCP protocol, which can be useful for OAuth callbacks, health checks, or admin APIs. The handler function must be an async function that accepts a Starlette Request and returns a Response. Args: path: URL path for the route (e.g., "/auth/callback") methods: List of HTTP methods to support (e.g., ["GET", "POST"]) name: Optional name for the route (to reference this route with Starlette's reverse URL lookup feature) include_in_schema: Whether to include in OpenAPI schema, defaults to True Example: Register a custom HTTP route for a health check endpoint: ```python @server.custom_route("/health", methods=["GET"]) async def health_check(request: Request) -> Response: return JSONResponse({"status": "ok"}) ``` r\(Callable[[Request], Awaitable[Response]]r`c `jt||S)N)endpointrr^r)rrrr/)r\rrr^rrs rg decoratorz'FastMCP.custom_route..decoratorbsH  ( / /#&7    Iri)r\rr`rrf)rrrr^rrs````` rg custom_routezFastMCP.custom_route@sBD          rilist[BaseRoute]ct|j}|jD]0}|j}||1|S)zGet all additional HTTP routes including from mounted servers. Returns a list of all custom HTTP routes from this server and recursively from all mounted servers. Returns: List of Starlette BaseRoute objects )rrrrw_get_additional_http_routesextend)rroutesmounted_servermounted_routess rgrz#FastMCP._get_additional_http_routesrsVd233#3 * *N+2NNPPN MM. ) ) ) ) ri list[MCPTool]c@Ktdjdtjj4d{Vd{V}fd|Dcdddd{VS#1d{VswxYwYdS)zg List all available tools, in the format expected by the low-level MCP server. [z] Handler called: list_toolsrSNcRg|]#}||jj$S)r^r) to_mcp_toolr%r.0rrs rg z+FastMCP._list_tools_mcp..sK    )-)B!ri)rrr^rrwrkrl_list_tools_middleware)rrs` rgrBzFastMCP._list_tools_mcpsN  @@@@AAA>)11$1??        5577777777E "                               (B  BB list[Tool]cjKtjj|4d{V}t t jdddd|}t| ||j d{Vcdddd{VS#1d{VswxYwYdS) zD List all available tools, applying MCP middleware. rSNz tools/listmethodclientrequestrXsourcerr fastmcp_contextrkr) rrwrkrlr>rsrtListToolsRequestrr _list_toolsr fastmcp_ctx mw_contexts rgrzFastMCP._list_tools_middlewaresb >)11$1??       ;* 22,2GG# + J,,&$2B-                              A!B"" B,/B,-MiddlewareContext[mcp.types.ListToolsRequest]c Kjd{V}fd|D}d|D}jD]} |jd{V}|D]R}|s|j}|jr'|jd|j}| |}|||<Sx#t$ri} tt|dddt|} td| d | tjjrYd} ~ d} ~ wwxYwt%|S) z+ List all available tools. Nc>g|]}||Srfrnrs rgrz'FastMCP._list_tools..s=   T5R5RSW5X5X    rici|] }|j| Srfr)rrs rg z'FastMCP._list_tools..s%P%P%Pdh%P%P%Prir$rrwr^z)Failed to list tools from mounted server r)rrrrrwrrnr%rrrgetattrreprrrrrrr) rrk local_toolsfiltered_localrrrrr%r server_names ` rgrzFastMCP._list_toolss!.88::::::::     (//11   &Q%P%P%P%P ,  G $+N$I$I$K$KKKKKKK ' * *D88>>! (C~8!(<<$(<<#377%)IcNN *   %GXt44fd7mm T TTQRTT#J I$$&&'''A4C EAD<<Elist[MCPResource]c@Ktdjdtjj4d{Vd{V}fd|Dcdddd{VS#1d{VswxYwYdS)zk List all available resources, in the format expected by the low-level MCP server. rz ] Handler called: list_resourcesrSNcRg|]#}||jj$S))r\r)to_mcp_resourcer%rrrrs rgrz/FastMCP._list_resources_mcp..sK  (( )-)B)ri)rrr^rrwrkrl_list_resources_middleware)rrs` rgrDzFastMCP._list_resources_mcpsN  DDDDEEE>)11$1??        "==????????I !*                               rlist[Resource]c.Ktjj|4d{V}t iddd|}t |||jd{Vcdddd{VS#1d{VswxYwYdS)zH List all available resources, applying MCP middleware. rSNr r zresources/listr r)rrwrkrlr>rr_list_resourcesrs rgr'z"FastMCP._list_resources_middlewaresO >)11$1??       ;*' + J,,&$2F-                              AB BB!MiddlewareContext[dict[str, Any]]c Kjd{V}fd|D}d|D}jD] } |jd{V}|D]m}|s|j}|jrBt|j|j}| |d|jd|j i}|||<n#t$rj} tt|dddt|} td| d | t"jjrYd} ~ d} ~ wwxYwt)|S) z/ List all available resources. Nc>g|]}||Srfrr&s rgrz+FastMCP._list_resources..=   ,,X66    rici|] }|j| Srfr)rrs rgrz+FastMCP._list_resources..s). . . '/HL(. . . rir^r$rrwzFailed to list resources from r)rrrrrwr'rnr%rrrr^rrrrrrrrr) rrklocal_resourcesrrrrrr%rr s ` rgr*zFastMCP._list_resourcess!% 6 D D F FFFFFFF    +2244   . . 3A. . . ,  G (/(Q(Q(S(S"S"S"S"S"S"S / 2 2H88BB! ",C~1(,OO#+#6#6 #$*w~,O,O ,O,O#P$7$$ *2M#&& 2   %GXt44fd7mm T TTQRTTUUU#J M((**+++BC** E4AEElist[MCPResourceTemplate]c@Ktdjdtjj4d{Vd{V}fd|Dcdddd{VS#1d{VswxYwYdS)zt List all available resource templates, in the format expected by the low-level MCP server. rz)] Handler called: list_resource_templatesrSNcRg|]#}||jj$S)) uriTemplater)to_mcp_templater%rrrrs rgrz8FastMCP._list_resource_templates_mcp..:sK  (( ( )-)B)ri)rrr^rrwrkrl#_list_resource_templates_middleware)rrs` rgrFz$FastMCP._list_resource_templates_mcp1sN  MMMMNNN>)11$1??        "FFHHHHHHHHI !*                               rlist[ResourceTemplate]c.Ktjj|4d{V}t iddd|}t |||jd{Vcdddd{VS#1d{VswxYwYdS)zR List all available resource templates, applying MCP middleware. rSNr r zresources/templates/listr r)rrwrkrlr>rr_list_resource_templatesrs rgr9z+FastMCP._list_resource_templates_middlewareBsO >)11$1??       ;*1 + J,,&$2O-                              r+c Kjd{V}fd|D}d|D}jD] } |jd{V}|D]m}|s|j}|jrBt|j|j}| |d|jd|j i}|||<n#t$rj} tt|dddt|} td| d | t"jjrYd} ~ d} ~ wwxYwt)|S) z8 List all available resource templates. Nc>g|]}||Srfrr8s rgrz4FastMCP._list_resource_templates..br/rici|] }|j| Srfr)rrs rgrz4FastMCP._list_resource_templates..ks)6 6 6 '/HL(6 6 6 rir^r$rrwz'Failed to list resource templates from r)rrrrrwr9rnr%rrrr^rrrrrrrrr) rrklocal_templatesrrrrrr%rr s ` rgr<z FastMCP._list_resource_templatesYs !% 6 M M O OOOOOOO    +2244   6 6 3A6 6 6 ,  G !.LLNNNNNNNN !0 2 2H88BB! ",C~1(,OO#+#6#6 #$*w~,O,O ,O,O#P$7$$ *2M#&& 2   %GXt44fd7mm RkRRqRR#J M((**+++r2list[MCPPrompt]c@Ktdjdtjj4d{Vd{V}fd|Dcdddd{VS#1d{VswxYwYdS)zi List all available prompts, in the format expected by the low-level MCP server. rz] Handler called: list_promptsrSNcRg|]#}||jj$Sr) to_mcp_promptr%rrrrs rgrz-FastMCP._list_prompts_mcp..sK  $$)-)B%ri)rrr^rrwrkrl_list_prompts_middleware)rrs` rgrHzFastMCP._list_prompts_mcpsN  BBBBCCC>)11$1??         99;;;;;;;;G &                               r list[Prompt]cjKtjj|4d{V}t t jdddd|}t| ||j d{Vcdddd{VS#1d{VswxYwYdS) zG List all available prompts, applying MCP middleware. rSNz prompts/listrr r r r) rrwrkrlr>rsrtListPromptsRequestrr _list_promptsrs rgrFz FastMCP._list_prompts_middlewaresb >)11$1??       ;* 44N4KK% + J,,&$2D-                              r/MiddlewareContext[mcp.types.ListPromptsRequest]c Kjd{V}fd|D}d|D}jD]} |jd{V}|D]R}|s|j}|jr'|jd|j}| |}|||<Sx#t$ri} tt|dddt|} td| d | tjjrYd} ~ d} ~ wwxYwt%|S) z- List all available prompts. Nc>g|]}||SrfrrEs rgrz)FastMCP._list_prompts..s=   ,,V44    rici|] }|j| Srfr)rrs rgrz)FastMCP._list_prompts..s)* * * #)FJ* * * rir$rrwr^z+Failed to list prompts from mounted server r)rrrrrwrFrnr%rrrrrrrrrrr) rrk local_promptsrrrrrr%rr s ` rgrJzFastMCP._list_promptss#2>>@@@@@@@@     '..00   * * -;* * * ,  G &-n&M&M&O&O O O O O O O + . .F88@@!  *C~>&*>>!'!2!2s!2!;!;'-K$$ .   %GXt44fd7mm V+VVSTVV#J K&&(()))r!rdict[str, Any]Ylist[ContentBlock] | tuple[list[ContentBlock], dict[str, Any]] | mcp.types.CallToolResultc Ktd|jd||tjj|4d{V d} |jj}|j j r |j j }n#ttf$rYnwxYw||d{V}|r#||r t!|dr|jj}|dkr)|s't't)t*d|d |r\|d krVt-|t.rA|d }t3||||d{V cdddd{VS|rb|d kr\t4jt4jd d|dgd ddd iicdddd{VS|||d{V}|cdddd{VS#t@$r} tCd|| d} ~ wtB$r} tCd|| d} ~ wwxYw#1d{VswxYwYdS)aR Handle MCP 'callTool' requests. Detects SEP-1686 task metadata and routes to background execution if supported. Args: key: The name of the tool to call arguments: Arguments to pass to the tool Returns: List of MCP Content objects containing the tool results rz&] Handler called: call_tool %s with %srSNr rTzTool 'rUrVrTrYr]r[)rr]r`ra)rqisErrorrcr)"rrr^rrwrkrlrrerfrgrhrirjrrnror r rr#rrrErrCrsrtCallToolResult TextContent_call_tool_middleware to_mcp_resultr0r1) rr%rr~rrrrrrs rgrJzFastMCP._call_tool_mcps&  A A A A3    >)11$1??B CB CB CB CB CB CB CB CA C *:C'/C$'$4$B & 4D "<$:DA"# 8  [B CB CB CB CB CB CB CB CB CB CB CB CB CB Cz $99#yIIIIIIII++--}B CB CB CB CB CB CB CB CB CB CB CB CB CB C~! C C C#$:S$:$:;;B  C C C#$:S$:$:;;B CCB CB CB CB CB CB CB CB CB CB CB CB CB CB CB CB CsnIH$A=<H=BHBC H1AH/H I!H44 IIII I&)I&rFcKtttj||dddtjj}|||j d{VS)b Applies this server's middleware and delegates the filtered call to the manager. r^rr r z tools/callr rN) r>r!rsrtrrw dependencies get_contextr _call_tool)rr%rrs rgrVzFastMCP._call_tool_middlewareCs''<=I33 3RR#N7CCEE    ++$/,         ri2MiddlewareContext[mcp.types.CallToolRequestParams]cK|jj}t|jD]}|}|jr=||jds)|t |jdzd} |j|d{V}| |s|j ||jj pid{VcS#t$rYwxYw |j |d{V}| |r.|j ||jj pid{VSn#t$rYnwxYwtd|)z Call a tool r$N)r%rr)rXr^rrr startswithlenrwrrnrVrr1rrI)rrk tool_namertry_namers rgr]zFastMCP._call_toolWs O(   566  G H~ @ ++w~,@,@,@AA$S%8%81%<%>%>? %^44X>>>>>>>>44T::$^AAgo7=2!     +44Y????????D,,T22 !/99!W_-F-L":     D :Y::;;;s+,5C",C CC"A"E EE AnyUrl | strlist[ReadResourceContents]cKtd|jd|tjj|4d{V tt| |d{Vcdddd{VS#t$r%}tdt||d}~wt$r%}tdt||d}~wwxYw#1d{VswxYwYdS)z Handle MCP 'readResource' requests. Delegates to _read_resource, which should be overridden by FastMCP subclasses. rz"] Handler called: read_resource %srSNr) rrr^rrwrkrlrr_read_resource_middlewarer0r1r_)rr\rs rgrpzFastMCP._read_resource_mcps  FFFFLLL>)11$1?? N N N N N N N N N0188======== N N N N N N N N N N N N N N ! N N N#$ES$E$EFFAM  N N N#$ES$E$EFFAM N N N N N N N N N N N N N N N N Ns<C82B C5# C C5 C00C55C88 DDcVKt|trt|n|}ttj|dddtjj }t| ||j d{VS)rY)r\r r zresources/readr rN)rr_r*r>rsrtReadResourceRequestParamsrrwr[r\rr_read_resource)rr\ uri_paramrs rgrhz!FastMCP._read_resource_middlewares$.c3#7#7@F3KKKS &I77I7FF##N7CCEE    (("d.A)         ri6MiddlewareContext[mcp.types.ReadResourceRequestParams]cKt|jj}t|jD]}|}|jr+t ||js!t||j}|j |d{V}|Y| |so t|j |d{V}|cS#t$rYwxYw |j|d{V}| |r7|j|d{V}t#||jgSn#t$rYnwxYwtd|)z! Read a resource N)rqrvr)r_rXr\rrrhas_resource_prefixremove_resource_prefixrwrmrnrrhr1rr read_resourcerrv)rrkuri_strrr%rrrqs rgrkzFastMCP._read_resourcesgo)**  566  GC~ B*3??,S'.AA %^MMcRRRRRRRRH00::  GN$L$LS$Q$QQQQQQQRR       !3@@IIIIIIIIH,,X66  $ 6 D DW M MMMMMMM( '"*"4     D <<<===s% .C CC"A+E EEdict[str, Any] | Noner$cKddl}td|jd|||jj|4d{V |||d{V cdddd{VS#t$r}td||d}~wt$r}td||d}~wwxYw#1d{VswxYwYdS)z Handle MCP 'getPrompt' requests. Delegates to _get_prompt, which should be overridden by FastMCP subclasses. rNrz'] Handler called: get_prompt %s with %srSr) fastmcp.server.contextrrr^rwrkrl_get_prompt_middlewarer0r1)rr^rrrs rgrzFastMCP._get_prompt_mcps &%%% B B B BD)   >)11$1?? F F F F F F F F F!88yIIIIIIIII F F F F F F F F F F F F F F! F F F#$=t$=$=>>AE  F F F#$=t$=$=>>AE F F F F F F F F F F F F F F F F Fs<CB C B  C-CCC CCcKttj||dddtjj}|||j d{VS)rYrZr r z prompts/getr rN) r>rsrtGetPromptRequestParamsrrwr[r\r _get_prompt)rr^rrs rgrvzFastMCP._get_prompt_middlewares'I44$)4TT #N7CCEE    ++$*:,         ri3MiddlewareContext[mcp.types.GetPromptRequestParams]cK|jj}t|jD]}|}|jr=||jds)|t |jdzd} |j|d{V}| |s|j ||jj d{VcS#t$rYwxYw |j |d{V}| |r,|j ||jj d{VSn#t$rYnwxYwtd|)Nr$r`rZr)rXr^rrrrarbrwrrnrvrr1r render_prompt)rrkr^rrdrs rgryzFastMCP._get_prompt s#  566  GH~ ;'.';';';<<GN 3 3a 7 9 9:  '~88BBBBBBBB44V<<$^BBgo7!     /::4@@@@@@@@F,,V44 !1??)B@     D 7t77888s+,5C"*C CC A E EErc|j| ddlm}|}|n#t $rYnwxYw|S)aXAdd a tool to the server. The tool function can optionally request a Context object by adding a parameter with the Context type annotation. See the @tool decorator for examples. Args: tool: The Tool instance to register Returns: The tool instance that was added to the server. rr\)rrrr\_queue_tool_list_changedr)rrr\rks rgrzFastMCP.add_tool3sy ##D)))  ? ? ? ? ? ?!kmmG  , , . . . .    D  $A A Ac|j| ddlm}|}|dS#t $rYdSwxYw)zRemove a tool from the server. Args: name: The name of the tool to remove Raises: NotFoundError: If the tool is not found rr~N)r remove_toolrr\rr)rr^r\rks rgrzFastMCP.remove_toolLsw &&t,,,  ? ? ? ? ? ?!kmmG  , , . . . . .    DD s$A AArctransformationrHc<|j||dS)zAdd a tool transformation.N)radd_tool_transformation)rrcrs rgrzFastMCP.add_tool_transformation`s# 229nMMMMMric:|j|dS)zRemove a tool transformation.N)rremove_tool_transformation)rrcs rgrz"FastMCP.remove_tool_transformationfs 55i@@@@@ri r^title descriptionrtags output_schemar exclude_argsmetaenabledtask name_or_fnr rrrset[str] | Nonerdict[str, Any] | NotSetT | Noner'ToolAnnotations | dict[str, Any] | Nonerlist[str] | Nonerrrbool | TaskConfig | NonerEc dSrerf rrr^rrrrrrrrrrs rgrz FastMCP.tooljs sri%Callable[[AnyFunction], FunctionTool]c dSrerfrs rgrz FastMCP.tool|s 14ristr | AnyFunction | None4Callable[[AnyFunction], FunctionTool] | FunctionToolc Xt|tr td i|}t|tr!t t jdt j|rL|} |}| | n|j}tj | |||||||| | |j | | }| ||St|tr|td|d|d|}n$||}ntdt|t!|j|||||||| | | |  S) amDecorator to register a tool. Tools can optionally request a Context object by adding a parameter with the Context type annotation. The context provides access to MCP capabilities like logging, progress reporting, and resource access. This decorator supports multiple calling patterns: - @server.tool (without parentheses) - @server.tool (with empty parentheses) - @server.tool("custom_name") (with name as first argument) - @server.tool(name="custom_name") (with name as keyword argument) - server.tool(function, name="custom_name") (direct function call) Args: name_or_fn: Either a function (when used as @tool), a string name, or None name: Optional name for the tool (keyword-only, alternative to name_or_fn) description: Optional description of what the tool does tags: Optional set of tags for categorizing the tool output_schema: Optional JSON schema for the tool's output annotations: Optional annotations about the tool's behavior exclude_args: Optional list of argument names to exclude from the tool schema. Note: `exclude_args` will be deprecated in FastMCP 2.14 in favor of dependency injection with `Depends()` for better lifecycle management. meta: Optional meta information about the tool enabled: Optional boolean to enable or disable the tool Examples: Register a tool with a custom name: ```python @server.tool def my_tool(x: int) -> str: return str(x) # Register a tool with a custom name @server.tool def my_tool(x: int) -> str: return str(x) @server.tool("custom_name") def my_tool(x: int) -> str: return str(x) @server.tool(name="custom_name") def my_tool(x: int) -> str: return str(x) # Direct function call server.tool(my_function, name="custom_name") ``` aA To decorate a classmethod, first define the method and then call tool() directly on the method instead of using it as a decorator. See https://gofastmcp.com/patterns/decorating-methods for examples and more information. N) r^rrrrrrrrrrrzXCannot specify both a name as first argument and as keyword argument. Use either @tool('z') or @tool(name=' '), not both.zAFirst argument to @tool must be a function, string, or None, got rrf)rrr% classmethodr7inspectcleandoc isroutinerr)rrrr_ TypeErrorrrr)rrr^rrrrrrrrrrr\rc supports_taskrs rgrz FastMCP.toolsD k4 ( ( 9)88K88K j+ . .       Z ( (- BI(d.L  %'+')0"D MM$   K  C ( ( [)3[[GK[[[#II  IIfTXYcTdTdff   I#'#%    rirc|j| ddlm}|}|n#t $rYnwxYw|S)zAdd a resource to the server. Args: resource: A Resource instance to add Returns: The resource instance that was added to the server. rr~)r add_resourcerr\_queue_resource_list_changedr)rrr\rks rgrzFastMCP.add_resourcey ++H555  ? ? ? ? ? ?!kmmG  0 0 2 2 2 2    D rrc|j| ddlm}|}|n#t $rYnwxYw|S)zAdd a resource template to the server. Args: template: A ResourceTemplate instance to add Returns: The template instance that was added to the server. rr~)r add_templaterr\rr)rrr\rks rgrzFastMCP.add_template5rr) r^rrrrvrrrrrrv#Annotations | dict[str, Any] | None4Callable[[AnyFunction], Resource | ResourceTemplate]c  t tr tdi  tjrt dd   f d } | S) aDecorator to register a function as a resource. The function will be called when the resource is read to generate its content. The function can return: - str for text content - bytes for binary content - other types will be converted to JSON Resources can optionally request a Context object by adding a parameter with the Context type annotation. The context provides access to MCP capabilities like logging, progress reporting, and session information. If the URI contains parameters (e.g. "resource://{param}") or the function has parameters, it will be registered as a template resource. Args: uri: URI for the resource (e.g. "resource://my-resource" or "resource://{param}") name: Optional name for the resource description: Optional description of the resource mime_type: Optional MIME type for the resource tags: Optional set of tags for categorizing the resource enabled: Optional boolean to enable or disable the resource annotations: Optional annotations about the resource's behavior meta: Optional meta information about the resource Examples: Register a resource with a custom name: ```python @server.resource("resource://my-resource") def get_data() -> str: return "Hello, world!" @server.resource("resource://my-resource") async get_data() -> str: data = await fetch_data() return f"Hello, world! {data}" @server.resource("resource://{city}/weather") def get_weather(city: str) -> str: return f"Weather for {city}" @server.resource("resource://{city}/weather") async def get_weather_with_context(city: str, ctx: Context) -> str: await ctx.info(f"Fetching weather for {city}") return f"Weather for {city}" @server.resource("resource://{city}/weather") async def get_weather(city: str) -> str: data = await fetch_weather(city) return f"Weather for {city}: {data}" ``` zrThe @resource decorator was used incorrectly. Did you forget to call it? Use @resource('uri') instead of @resourcer\r r`Resource | ResourceTemplatec t|tr!ttjdnj}dvodv}ddlm}||}ttj |j }|s|r7tj |   | } ||S|s9|s7tj |   | }||Std) NaY To decorate a classmethod, first define the method and then call resource() directly on the method instead of using it as a decorator. See https://gofastmcp.com/patterns/decorating-methods for examples and more information. {}r)without_injected_parameters) r\rr^rrrrvrrrrr) r\r\r^rrrrvrrrrrziInvalid resource or template definition due to a mismatch between URI parameters and function parameters.)rrr7rrrrrr, signature parametersr(rrr'r)r\rhas_uri_paramsr wrapper_fnhas_func_paramsrrrrrrrrvr^rrrrr\s rgrz#FastMCP.resource..decorators"k**  $   (d.L  !CZ6C3JN O O O O O O44R88J"7#4Z#@#@#KLLO& & +9!$ +'# +&   !!(+++# O #1 +'# +&   !!(+++ Orirf)r\r r`r)rrrrrr) rr\r^rrrrvrrrrrrs ```````````` rgrzFastMCP.resourceKsF k4 ( ( 5%44 44K  S ! ! W  @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ Drirc|j| ddlm}|}|n#t $rYnwxYw|S)zAdd a prompt to the server. Args: prompt: A Prompt instance to add Returns: The prompt instance that was added to the server. rr~)r add_promptrr\_queue_prompt_list_changedr)rrr\rks rgrzFastMCP.add_promptsy ''///  ? ? ? ? ? ?!kmmG  . . 0 0 0 0    D  rr^rrrrrrrr3cdSrerf rrr^rrrrrrrs rgrzFastMCP.prompts ri'Callable[[AnyFunction], FunctionPrompt]cdSrerfrs rgrzFastMCP.prompt s 36#ri8Callable[[AnyFunction], FunctionPrompt] | FunctionPromptc t|tr!ttjdtj|rC|} |} | | n|j} tj| | |||||||  } | | | St|tr|td|d|d|} n$||} ntdt|t|j| |||||||  S) a Decorator to register a prompt. Prompts can optionally request a Context object by adding a parameter with the Context type annotation. The context provides access to MCP capabilities like logging, progress reporting, and session information. This decorator supports multiple calling patterns: - @server.prompt (without parentheses) - @server.prompt() (with empty parentheses) - @server.prompt("custom_name") (with name as first argument) - @server.prompt(name="custom_name") (with name as keyword argument) - server.prompt(function, name="custom_name") (direct function call) Args: name_or_fn: Either a function (when used as @prompt), a string name, or None name: Optional name for the prompt (keyword-only, alternative to name_or_fn) description: Optional description of what the prompt does tags: Optional set of tags for categorizing the prompt enabled: Optional boolean to enable or disable the prompt meta: Optional meta information about the prompt Examples: ```python @server.prompt def analyze_table(table_name: str) -> list[Message]: schema = read_table_schema(table_name) return [ { "role": "user", "content": f"Analyze this schema: {schema}" } ] @server.prompt() async def analyze_with_context(table_name: str, ctx: Context) -> list[Message]: await ctx.info(f"Analyzing table {table_name}") schema = read_table_schema(table_name) return [ { "role": "user", "content": f"Analyze this schema: {schema}" } ] @server.prompt("custom_name") async def analyze_file(path: str) -> list[Message]: content = await read_file(path) return [ { "role": "user", "content": { "type": "resource", "resource": { "uri": f"file://{path}", "text": content } } } ] @server.prompt(name="custom_name") def another_prompt(data: str) -> list[Message]: return [{"role": "user", "content": data}] # Direct function call server.prompt(my_function, name="custom_name") ``` aC To decorate a classmethod, first define the method and then call prompt() directly on the method instead of using it as a decorator. See https://gofastmcp.com/patterns/decorating-methods for examples and more information. N) r\r^rrrrrrrzZCannot specify both a name as first argument and as keyword argument. Use either @prompt('z') or @prompt(name='rzCFirst argument to @prompt must be a function, string, or None, got r)rrr7rrrrr&rrr_rrrr)rrr^rrrrrrrr\ prompt_namerrs rgrzFastMCP.prompt sf j+ . .       Z ( () BK(d.L  ) '"   F OOF # # #M  C ( ( _+5__KO___%KK  KKhVZ[eVfVfhh   K#    ric hK|rt|dt|5|4d{Vt4d{V\}}td|jdt}|j |||j td|d{Vdddd{Vn#1d{VswxYwYdddd{Vn#1d{VswxYwYddddS#1swxYwYdS) zRun the server using stdio transport. Args: show_banner: Whether to display the server banner log_level: Log level for the server rr)rwr2NStarting MCP server z with transport 'stdio'T) tools_changed)notification_optionsexperimental_capabilities) rIrLr.rrinfor^r?rr>create_initialization_optionsr)rr4r read_stream write_streamrs rgr8zFastMCP.run_stdio_async s   !     ! + +  --//        '>>-Hk<KKStySSS 1F0G0G-*..#$(FF1D.22227P G                                                      sZD'D A?C&D & C0 0D 3C0 4D 7D' D D'D D''D+.D+rs)Literal['http', 'streamable-http', 'sse']uvicorn_configlist[ASGIMiddleware] | Nonec K|p |jj}|p |jj}|p |jj} ||||| | } t | dr4t | jdr| jj dn|pd} |rt||||| |pi}ddd d }| |d |vr d |vr| |d <t|5| 4d {Vtj| f||d|}tj|}| jj d}t"d|jd|d|d|d| |d {Vd d d d {Vn#1d {VswxYwYd d d d S#1swxYwYd S)a*Run the server using HTTP transport. Args: transport: Transport protocol to use - either "streamable-http" (default) or "sse" host: Host address to bind to (defaults to settings.host) port: Port to bind to (defaults to settings.port) log_level: Log level for the server (defaults to settings.log_level) path: Path for the endpoint (defaults to settings.streamable_http_path or settings.sse_path) uvicorn_config: Additional configuration for the Uvicorn server middleware: A list of middleware to apply to the app json_response: Whether to use JSON response format (defaults to settings.json_response) stateless_http: Whether to use stateless HTTP (defaults to settings.stateless_http) )rr2rrrstater/)rwr2rrrronzwebsockets-sansio)timeout_graceful_shutdownrws log_configrN)rrrz with transport z on http://:)rrrrlowerhttp_approrrlstriprIrrLr.uvicornConfigServerrrr^serve)rr4r2rrrrrrrrdefault_log_level_to_useapp server_pathuvicorn_config_from_user config_kwargsconfigrws rgr9zFastMCP.run_http_async s!45t055t05  <2< %'' !mm!')   sG$$ )0F)C)C CIN ! !# & & &    #     $2#7R *+%) ) 5666 } , ,M1Q1Q)AM+ &  + + % %--// % % % % % % % % S$TSS]SS //y~,,S11 t49tt tt`dttgkttnrttllnn$$$$$$$ % % % % % % % % % % % % % % % % % % % % % % % % % % % % % % % % % % % % % % % % % % % % %s72G BF0G0 F: :G=F: >GGG event_storeEventStore | Noneretry_intervalr:c ,|dvrOt||p |jj|||j||n |jj||n |jj|jj| S|dkr:t||jj|p |jj |j|jj|SdS)a2Create a Starlette app using the specified HTTP transport. Args: path: The path for the HTTP endpoint middleware: A list of middleware to apply to the app json_response: Whether to use JSON response format stateless_http: Whether to use stateless mode (new transport per request) transport: Transport protocol to use - "http", "streamable-http", or "sse" event_store: Optional event store for SSE polling/resumability. When set, enables clients to reconnect and resume receiving events after server-initiated disconnections. Only used with streamable-http transport. retry_interval: Optional retry interval in milliseconds for SSE polling. Controls how quickly clients should reconnect after server-initiated disconnections. Requires event_store to be set. Only used with streamable-http transport. Returns: A Starlette application configured with the specified transport )rursN) rwrrrrrrrrrt)rwrrrrr) r<rrrrrrr;rr)rrrrrr2rrs rgrzFastMCP.http_app s< 3 3 3-%)&B,A'-Y%0"M2@&1#N2A/5%% (%  !!6CC!:!CY/5%   rirvas_proxycddlm}||jtk}|r*t ||st |}d|_t||}|j |dS)a Mount another FastMCP server on this server with an optional prefix. Unlike importing (with import_server), mounting establishes a dynamic connection between servers. When a client interacts with a mounted server's objects through the parent server, requests are forwarded to the mounted server in real-time. This means changes to the mounted server are immediately reflected when accessed through the parent. When a server is mounted with a prefix: - Tools from the mounted server are accessible with prefixed names. Example: If server has a tool named "get_weather", it will be available as "prefix_get_weather". - Resources are accessible with prefixed URIs. Example: If server has a resource with URI "weather://forecast", it will be available as "weather://prefix/forecast". - Templates are accessible with prefixed URI templates. Example: If server has a template with URI "weather://location/{id}", it will be available as "weather://prefix/location/{id}". - Prompts are accessible with prefixed names. Example: If server has a prompt named "weather_prompt", it will be available as "prefix_weather_prompt". When a server is mounted without a prefix (prefix=None), its tools, resources, templates, and prompts are accessible with their original names. Multiple servers can be mounted without prefixes, and they will be tried in order until a match is found. There are two modes for mounting servers: 1. Direct mounting (default when server has no custom lifespan): The parent server directly accesses the mounted server's objects in-memory for better performance. In this mode, no client lifecycle events occur on the mounted server, including lifespan execution. 2. Proxy mounting (default when server has a custom lifespan): The parent server treats the mounted server as a separate entity and communicates with it via a Client transport. This preserves all client-facing behaviors, including lifespan execution, but with slightly higher overhead. Args: server: The FastMCP server to mount. prefix: Optional prefix to use for the mounted server's objects. If None, the server's objects are accessible with their original names. as_proxy: Whether to treat the mounted server as a proxy. If None (default), automatically determined based on whether the server has a custom lifespan (True if it has a custom lifespan, False otherwise). rrXNT)rrw) fastmcp.server.proxyrYrrzrrrr MountedServerrrr)rrwrrrYrs rgmountz FastMCP.mountY sd 655555  '+;;H  .Jv|<< .%%f--F "'    $$^44444ric K|d{VD]<\}}|r||d|}|j|=|d{VD]T\}}|r3t ||}|d|d|ji|}|j |U| d{VD]T\}}|r3t ||}|d|d|ji|}|j |U| d{VD]<\}} |r| |d|} |j | =|jt krddlm} | dt&d |r0t(d |jd |jd |ddSt(d |jd |jdS)ay Import the MCP objects from another FastMCP server into this one, optionally with a given prefix. Note that when a server is *imported*, its objects are immediately registered to the importing server. This is a one-time operation and future changes to the imported server will not be reflected in the importing server. Server-level configurations and lifespans are not imported. When a server is imported with a prefix: - The tools are imported with prefixed names Example: If server has a tool named "get_weather", it will be available as "prefix_get_weather" - The resources are imported with prefixed URIs using the new format Example: If server has a resource with URI "weather://forecast", it will be available as "weather://prefix/forecast" - The templates are imported with prefixed URI templates using the new format Example: If server has a template with URI "weather://location/{id}", it will be available as "weather://prefix/location/{id}" - The prompts are imported with prefixed names Example: If server has a prompt named "weather_prompt", it will be available as "prefix_weather_prompt" When a server is imported without a prefix (prefix=None), its tools, resources, templates, and prompts are imported with their original names. Args: server: The FastMCP server to import prefix: Optional prefix to use for the imported server's objects. If None, objects are imported with their original names. Nr$rr^)rr%r)rnzeWhen importing from a server with a lifespan, the lifespan from the imported server will not be used.r)rXcategoryrrz] Imported server z with prefix '')rrrrrrrr^rrrrrrrrrzrrnRuntimeWarningrr) rrwrr%rr resource_keyr template_keyrrns rg import_serverzFastMCP.import_server sJ!' 0 0 2 222222299;; . .IC >f+<+.reuse_client_factory^ s!Mric,Srenewrsrgfresh_client_factoryz.FastMCP.as_proxy..fresh_client_factoryd s!::<<'ric,Srer) base_clientsrgproxy_client_factoryz.FastMCP.as_proxy..proxy_client_factoryl s"(((riclient_factoryrf) fastmcp.client.clientrPrrYrr is_connectedrKrlr) rr rrPrYr proxy_loggerrrrrrr s @@rgrzFastMCP.as_proxy7 s. 100000BBBBBBBB gv & & 2F""$$ 6)(33 !!M """"""6((((("6%+g..K ) ) ) ) )2N|FF>FXFFFri componentrJcjsdS|j |jdS|j"tfd|jDrdS|j-t tfd|jDSdS)a Given a component, determine if it should be enabled. Returns True if it should be enabled; False if it should not. Rules: - If the component's enabled property is False, always return False. - If both include_tags and exclude_tags are None, return True. - If exclude_tags is provided, check each exclude tag: - If the exclude tag is a string, it must be present in the input tags to exclude. - If include_tags is provided, check each include tag: - If the include tag is a string, it must be present in the input tags to include. - If include_tags is provided and none of the include tags match, return False. - If include_tags is not provided, return True. FNTc3*K|] }|jvVdSrer)retagrs rg z3FastMCP._should_enable_component.. s*HHd49>)HHHHHHric3*K|] }|jvVdSrer!)ritagrs rgr#z3FastMCP._should_enable_component.. s*QQtDIN2QQQQQQri)rrranyr,)rrs `rgrnz FastMCP._should_enable_components s"  5   $):)B4   (HHHHd6GHHHHH u   (QQQQt?PQQQQQRR Rtric~|j}||dtjdS|d|dtjdS)N-r)rlsecrets token_hex)rr^ class_names rgrzFastMCP.generate_name sT\ < 997#4Q#7#799 9 @@4@@'*;A*>*>@@ @ri)NN)>r^rrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrr)r`r_)rrrrrrrrrrrrrrrrrrr`r)r`rD)r`r)rrr`r)r`r)r`r)r`r)rwrrrrrr`r)NT)r2r3r4r,r5rr`r)r`r)rkrrrr`r)rr+r`r)r`r)r%r_r`r))r%r_r`r)r\r_r`r)r`r)r%r_r`r')r`r)r%r_r`r()r`r)r%r_r`r&) rr_rrr^rrr,r`r)r`r)r`r)r`r)rkrr`r)r`r")r`r()rkr,r`r()r`r3)r`r:)rkr,r`r:)r`rA)r`rG)rkrKr`rG)r%r_rrPr`rQ)r%r_rrPr`rF)rkr^r`rF)r\rer`rf)rkrmr`rfre)r^r_rrsr`r$)rkrzr`r$)rr)r`r))r^r_r`r)rcr_rrHr`r)rcr_r`r)rr r^rrrrrrrrrrrrrrrrrsrrrrr`rE)rrr^rrrrrrrrrrrrrrrrrsrrrrr`r)rrr^rrrrrrrrrrrrrrrrrsrrrrr`r)rr'r`r')rr(r`r()r\r_r^rrrrrrrrvrrrrrrrrrsrrr`r)rr&r`r&)rr r^rrrrrrrrrrrrrsrrr`r3)rrr^rrrrrrrrrrrrrsrrr`r)rrr^rrrrrrrrrrrrrsrrr`r)TN)r4r,rrr`r) TrsNNNNNNNN)r4r,r2rrrrrrrrrrrsrrrrrrr`r)NNNNrsNN)rrrrrrrrr2rrrrrr`r:)rwrvrrrrr`r)rwrvrrr`r)NNNNN)rrPr rrrrrrrrrrrrrr`rU)NNNNNNN)rrr^rrrrrrrrrrrsrrrrr`rU)r r rrr`rY)rrJr`r,)r^rr`r_)Srl __module__ __qualname__rMrrrpropertyrr^rsetterrrrrr r"rr.r;r>rrKrLrMrrrrrrmrrrrrrrrrBrrrDr'r*rFr9r<rHrFrJrJrVr]rprhrkrrvryrrrrrrrrrrrr8r9rrrrrr rrnrrfrirgrrs?  #'L #"&-1.426,0*.<@IM;?/3/3,07;;?9=/3! !%!##'+/%)&*JNJNML L L L L L \7777%B%B%B%BN)))X)%%%X%---X-....(((X(,,,X,000X0 Xh0h0h0h0T????B%%%%:'+ @@@@@@'+      *---- @S@S@S@SD@P@P@P@PD2R2R2R2Rh $ $ $ $++++(     > @( "& 00000d$",+(+(+(+(Z",0,0,0,0,d".4,4,4,4,l"./*/*/*/*bYCYCYCYCv    (*<*<*<*.>.>.>b=AFFFFF4=A     $&9&9&9&9P2(NNNN AAAA   "&-1 $9??C)-&*#)-X""&4  "&-1 $9??C)-&*#)-44444X4&04O   "&-1 $9??C)-&*#)-O O O O O O b,4  "&-1 $ $#;?&*)-OOOOOOb,   "&-1 $#&*)-     X "& 6  "&-1 $#&*)- 6 6 6 6 6X 6 04V   "&-1 $#&*)-V V V V V V rAE#####N!?E $0426%)&*M%M%M%M%M%b 26%)&*?E)-%);;;;;@" $ F5F5F5F5F5V"OIOIOIOIOIb -1156:+/ $    [ 6 ,0156:+/59 $& & & & [& P9G9G9G[9Gv@AAAA[AAArirc$eZdZUded<ded<dS)rrrz FastMCP[Any]rwN)rlr,r-__annotations__rfrirgrr s*rirr\rc|s|St|}|std|d|\}}||d|S)aAdd a prefix to a resource URI using path formatting (resource://prefix/path). Args: uri: The original resource URI prefix: The prefix to add Returns: The resource URI with the prefix added Examples: ```python add_resource_prefix("resource://path/to/resource", "prefix") "resource://prefix/path/to/resource" ``` With absolute path: ```python add_resource_prefix("resource:///absolute/path", "prefix") "resource://prefix//absolute/path" ``` Raises: ValueError: If the URI doesn't match the expected protocol://path format Invalid URI format: ". Expected protocol://path format.r) URI_PATTERNmatchr7groups)r\rr6protocolrs rgrr su0     c " "E YWWWWXXX\\^^NHd ' ' ' ' ''ric*|s|St|}|std|d|\}}dt j|d}t j||}|s|S||dS)aoRemove a prefix from a resource URI. Args: uri: The resource URI with a prefix prefix: The prefix to remove Returns: The resource URI with the prefix removed Examples: ```python remove_resource_prefix("resource://prefix/path/to/resource", "prefix") "resource://path/to/resource" ``` With absolute path: ```python remove_resource_prefix("resource://prefix//absolute/path", "prefix") "resource:///absolute/path" ``` Raises: ValueError: If the URI doesn't match the expected protocol://path format r3r4^z/(.*?)$r`)r5r6r7r7reescapegroup)r\rr6r8rprefix_pattern path_matchs rgrprp s0     c " "E YWWWWXXX\\^^NHd46**333N.$//J   - ((++ - --rir,c |sdSt|}|std|d|\}}dt j|d}t t j||S)aPCheck if a resource URI has a specific prefix. Args: uri: The resource URI to check prefix: The prefix to look for Returns: True if the URI has the specified prefix, False otherwise Examples: ```python has_resource_prefix("resource://prefix/path/to/resource", "prefix") True ``` With other path: ```python has_resource_prefix("resource://other/path/to/resource", "prefix") False ``` Raises: ValueError: If the URI doesn't match the expected protocol://path format Fr3r4r:r)r5r6r7r7r;r<r,)r\rr6r$rr>s rgroro s0 u   c " "E YWWWWXXXllnnGAt.6**---N .. / //ri)r\r]r^r_r`r])rwrvr`rx)r{rvr`r|)r\r_rr_r`r_)r\r_rr_r`r,)__doc__ __future__rrrr;r)rrcollections.abcrrrrrr contextlibr r r r dataclassesrrjrpathlibrtypingrrrrrrr=rrrsrrrr mcp.server.lowlevel.helper_typesrmcp.server.lowlevel.serverrrmcp.server.stdiormcp.shared.exceptionsrrrr r!r"r#r$r%r& MCPPromptr' MCPResourcer(MCPResourceTemplater)MCPToolpydanticr*starlette.middlewarer+ASGIMiddlewarestarlette.requestsr,starlette.responsesr-starlette.routingr.r/rfastmcp.serverfastmcp.exceptionsr0r1fastmcp.mcp_configr2fastmcp.promptsfastmcp.prompts.promptr3fastmcp.prompts.prompt_managerr4fastmcp.resources.resourcer5"fastmcp.resources.resource_managerr6fastmcp.resources.templater7fastmcp.server.authr8fastmcp.server.event_storer9fastmcp.server.httpr:r;r<fastmcp.server.low_levelr=fastmcp.server.middlewarer>!fastmcp.server.tasks.capabilitiesr?fastmcp.server.tasks.configr@fastmcp.server.tasks.handlersrArBrCfastmcp.settingsrDfastmcp.tools.toolrErFfastmcp.tools.tool_managerrGfastmcp.tools.tool_transformrHfastmcp.utilities.clirIfastmcp.utilities.componentsrJfastmcp.utilities.loggingrKrLfastmcp.utilities.typesrMrNfastmcp.clientrPrrQfastmcp.client.transportsrRrSfastmcp.server.openapirTOpenAPIComponentFnrUrVrWOpenAPIRouteMapFnrrYfastmcp.server.sampling.handlerrZr[rlrrmDuplicateBehavior Transportcompiler5LifespanCallablerzrrrrrprorfrirgrys/;;""""""  "!!!!!GGGGGGGGGGGGGGGG !!!!!!!!AAAAAAKKKKKKKK))))))******                    *)))))------======%%%%%%======&&&&&&((((((........;;;;;;;;((((((""""""111111888888AAAAAAAA>>>>>>QQQQQQQQ,,,,,,111111 433333CCCCCCCCCCCCCC222222 &%%%%%==========222222<<<<<<333333999999EEEEEEEE33333333 <%%%%%%444444KKKKKKKKHHHHHH????????FFFFFF111111EEEEEE;;;;;; H  "@A = > bj-..  "=o"NN       0m+Am+Am+Am+Am+Ago&m+Am+Am+A`W   #(#(#(#(L).).).).X$0$0$0$0$0$0ri